Forensic domains name investigation tools

TLP:CLEAR

The CRDF Threat Center Forensic allows you to search for markers (IoCs) corresponding to infections. This system allows you to view the data associated with an IP address or a domain name over time. Thus, the system will be able to correlate all the data.

42,119,006 domais name analyzed and archived in the database
1 domais name awaiting analysis in the queue
Last update: Thursday 9th of February 2023 12:15:16 PM
Domain nameIPs associatedMalicious activityHistory dataDate AddedDate Updated
track-fs.q4az.in1Yes3about 1 minute agoabout 14 seconds ago
syj.hp1001.com1Yes3about 4 minutes agoabout 3 minutes ago
6884e542.kkw87t.shop1Yes3about 5 minutes agoabout 4 minutes ago
baloabaw.duckdns.org1Yes3about 5 minutes agoabout 4 minutes ago
ww16.6884e542.kkw87t.shop1Yes3about 5 minutes agoabout 4 minutes ago
careergames.com1Yes3about 6 minutes agoabout 5 minutes ago
redirect-service-es.blogspot.co.uk0Yes1about 7 minutes agoabout 6 minutes ago
brt-nbn.blogspot.cz1Yes3about 7 minutes agoabout 6 minutes ago
jerbux.blogspot.co.id0Yes1about 7 minutes agoabout 6 minutes ago
anchoredgrowlinbu.scrsalvrtual.repl.co1Yes3about 7 minutes agoabout 6 minutes ago
att-mail-102262.weeblysite.com2Yes4about 7 minutes agoabout 6 minutes ago
boiling-hulking-step.glitch.me4Yes6about 7 minutes agoabout 6 minutes ago
defiant-oceanic-staircase.glitch.me4Yes6about 7 minutes agoabout 6 minutes ago
biblitktrvp.lbrriasclr.repl.co1Yes3about 7 minutes agoabout 6 minutes ago
ganginthisbitch.info0Yes1about 8 minutes agoabout 7 minutes ago
debdattapal.in0Yes1about 10 minutes agoabout 9 minutes ago
log.login-office365-blandgarvey.in1Yes3about 11 minutes agoabout 10 minutes ago
khfoods.co.uk0Yes1about 13 minutes agoabout 12 minutes ago
messiahfellowship.org0Yes1about 13 minutes agoabout 12 minutes ago
cfcpublicschool.com1Yes3about 13 minutes agoabout 12 minutes ago
robloxflyhackpastebin.blogspot.sn1Yes3about 14 minutes agoabout 13 minutes ago
track-fs.chooseyourordernow.com0Yes1about 15 minutes agoabout 14 minutes ago
mobilefor.xyz2Yes4about 16 minutes agoabout 15 minutes ago
vrpnzdgfzaegfewmhjqfymdwjmevzfnqsoddxllkagvbmrqauq…1Yes3about 18 minutes agoabout 17 minutes ago
w.calmdefer.top2Yes4about 18 minutes agoabout 17 minutes ago
ymdxv.iuckforyou.net0Yes1about 18 minutes agoabout 17 minutes ago
ad0besecure.x24hr.com0Yes1about 18 minutes agoabout 17 minutes ago
682c6183.3xe5br.shop0Yes1about 20 minutes agoabout 19 minutes ago
kwordarbourziq-001-site1.etempurl.com1Yes3about 20 minutes agoabout 19 minutes ago
note.widely-considered.net0Yes1about 20 minutes agoabout 19 minutes ago
track-fs.collectours-toporder.com1Yes3about 23 minutes agoabout 22 minutes ago
profileid-bmo.com0Yes1about 24 minutes agoabout 23 minutes ago
fbmew.000webhostapp.com1Yes3about 25 minutes agoabout 24 minutes ago
47204782.000webhostapp.com1Yes3about 25 minutes agoabout 24 minutes ago
secure02-userciti32452432442.port25.biz0Yes1about 25 minutes agoabout 24 minutes ago
perrosgatitosadopcion201.000webhostapp.com1Yes3about 25 minutes agoabout 24 minutes ago
powenlucid.weebly.com2Yes4about 25 minutes agoabout 24 minutes ago
it.clickmobile-ml.com1Yes3about 25 minutes agoabout 24 minutes ago
rdgroup.com.np0Yes1about 25 minutes agoabout 24 minutes ago
9vw.hp1001.com1Yes3about 25 minutes agoabout 24 minutes ago
dirnewsiujeqw94.top0Yes1about 25 minutes agoabout 24 minutes ago
moveit.savvyint.com1Yes3about 26 minutes agoabout 25 minutes ago
yooofemmesfemmes.blogspot.al1Yes3about 26 minutes agoabout 25 minutes ago
mmecst354.xyz1Yes3about 27 minutes agoabout 26 minutes ago
classyadz.com1Yes3about 29 minutes agoabout 28 minutes ago
mail.19.wtemzv.rocks1Yes3about 29 minutes agoabout 28 minutes ago
wjhle.hp1001.com1Yes3about 29 minutes agoabout 28 minutes ago
100089970374644.my.id1Yes3about 30 minutes agoabout 29 minutes ago
lionfish-app-y5zx8.ondigitalocean.app0Yes1about 31 minutes agoabout 30 minutes ago
octopus-app-ur7va.ondigitalocean.app0Yes1about 31 minutes agoabout 30 minutes ago
nectarfeed.comhttps0Yes1about 32 minutes agoabout 31 minutes ago
eyapibireyselkampanyakatilimsayfasi.run.place1Yes3about 32 minutes agoabout 31 minutes ago
suivi-colissimo.net1Yes3about 34 minutes agoabout 33 minutes ago
rrbarbershop.com1Yes3about 34 minutes agoabout 33 minutes ago
starfish-app-bvrd6.ondigitalocean.app0Yes1about 34 minutes agoabout 33 minutes ago
index-secu9rehomlfifth3plugin.gettrials.com0Yes1about 34 minutes agoabout 33 minutes ago
srv186381.hoster-test.ru0Yes1about 34 minutes agoabout 33 minutes ago
logintoinstagramm.github.io4Yes6about 38 minutes agoabout 37 minutes ago
dsxrel.gq1Yes3about 38 minutes agoabout 37 minutes ago
srv186383.hoster-test.ru0Yes1about 38 minutes agoabout 37 minutes ago
lvaa.bridgette.app1Yes3about 38 minutes agoabout 37 minutes ago
userforuserdevelop.pages.dev2Yes4about 38 minutes agoabout 37 minutes ago
bcaloginnsvipgn.youtube-1988.my.id1Yes3about 38 minutes agoabout 37 minutes ago
bancoregionalparagauay.esperancita33.repl.co1Yes3about 38 minutes agoabout 37 minutes ago
ajskajsamwqw.confirmmbbaa.repl.co1Yes3about 38 minutes agoabout 37 minutes ago
bcalogingesahym.youtube-1988.my.id1Yes3about 38 minutes agoabout 37 minutes ago
34.accounu123.repl.co1Yes3about 39 minutes agoabout 38 minutes ago
vinci.tk1Yes3about 40 minutes agoabout 40 minutes ago
67t387hugcvxyb.we1de.co0Yes1about 41 minutes agoabout 40 minutes ago
clownfish-app-pguws.ondigitalocean.app0Yes1about 41 minutes agoabout 40 minutes ago
lionfish-app-uydyo.ondigitalocean.app0Yes1about 41 minutes agoabout 40 minutes ago
a0773021.xsph.ru0Yes1about 41 minutes agoabout 40 minutes ago
91tqft60554ftsc58f5.azurewebsites.net0Yes1about 41 minutes agoabout 40 minutes ago
main.coins-sollution.com0Yes1about 41 minutes agoabout 40 minutes ago
usrleslrhdk.com0Yes1about 42 minutes agoabout 41 minutes ago
darinmna.s3.us-west-004.backblazeb2.com3Yes5about 43 minutes agoabout 42 minutes ago
figakdquoruwuu.com1Yes3about 44 minutes agoabout 43 minutes ago
my-site-att-107369.weeblysite.com2Yes4about 44 minutes agoabout 43 minutes ago
yahoo-102275-107804.weeblysite.com2Yes4about 44 minutes agoabout 43 minutes ago
serviceedu5.weebly.com2Yes4about 45 minutes agoabout 44 minutes ago
mail.6.midasbuyshop.tech0Yes1about 45 minutes agoabout 44 minutes ago
mail.3.uiyrwjfk.cf0Yes1about 45 minutes agoabout 44 minutes ago
att-108020.weeblysite.com2Yes4about 45 minutes agoabout 44 minutes ago
att-109475.weeblysite.com2Yes4about 45 minutes agoabout 44 minutes ago
s1669759202114.ignaciob.com1Yes3about 47 minutes agoabout 46 minutes ago
legacoopsocialisicilia.it1Yes3about 48 minutes agoabout 47 minutes ago
67pay7825ui99ti69y.xyz0Yes1about 49 minutes agoabout 48 minutes ago
amz.fupfaj.cn0Yes1about 49 minutes agoabout 48 minutes ago
dev.latviesi.at1Yes3about 50 minutes agoabout 49 minutes ago
compralofacil.net1Yes3about 50 minutes agoabout 49 minutes ago
unimusic.info1Yes3about 50 minutes agoabout 49 minutes ago
34e6ec00-f2e1-453d-a752-e4b15765ee38.usrfiles.com0Yes1about 50 minutes agoabout 49 minutes ago
shitokaienborn.fr1Yes3about 51 minutes agoabout 50 minutes ago
acc234545-slgllns-updates-bill-pay.vantechddns.com2Yes4about 52 minutes agoabout 51 minutes ago
segurity-outlook-hotmail-0800.logi980.repl.co1Yes3about 54 minutes agoabout 54 minutes ago
bontlem.co.za1Yes3about 55 minutes agoabout 54 minutes ago
adidas-group.massagerrepublic.com1Yes3about 55 minutes agoabout 54 minutes ago
avito.sberbank.sberbank.sber.avito.covid19lockdown…0Yes1about 56 minutes agoabout 55 minutes ago
u1935374.cp.regruhosting.ru0Yes1about 57 minutes agoabout 57 minutes ago
digivio.top2Yes4about 58 minutes agoabout 57 minutes ago
att-support-email-100133.weeblysite.com2Yes4about 58 minutes agoabout 57 minutes ago
t.fpymi.iestpomate.edu.pe0Yes1about 1 hour agoabout 59 minutes ago
mail.6.ozymu.me0Yes1about 1 hour agoabout 1 hour ago
atnfnbew.boxmode.io0Yes1about 1 hour agoabout 1 hour ago
ai.botcontrolpanel.com2Yes4about 1 hour agoabout 1 hour ago
yandex-id.ru1Yes3about 1 hour agoabout 1 hour ago
junoemailingmailer.boxmode.io0Yes1about 1 hour agoabout 1 hour ago
vurtynu3.beget.tech1Yes3about 1 hour agoabout 1 hour ago
sfghtbyfo.xguildx2001.changeip.net1Yes3about 1 hour agoabout 1 hour ago
www70.magicmailers.com12Yes14about 1 hour agoabout 1 hour ago
junhongloh.com1Yes3about 1 hour agoabout 1 hour ago
iferterg.info1Yes3about 1 hour agoabout 1 hour ago
secure05achase-mobilesecurity.ddns.info0Yes1about 1 hour agoabout 1 hour ago
www70.erotik-hotel.de12Yes14about 1 hour agoabout 1 hour ago
cheb-hassni-ft-zahouaniya.malagatour.es1Yes3about 1 hour agoabout 1 hour ago
update-information.7f2qjcl.us0Yes1about 1 hour agoabout 1 hour ago
smbc-corp.vpasscard-bysumitomobank.com1Yes3about 1 hour agoabout 1 hour ago
sbb-swisspass-rechung.agvetprojects.com.au0Yes1about 1 hour agoabout 1 hour ago
amaz00n.info0Yes1about 1 hour agoabout 1 hour ago
cqshyzojbo.web.app1Yes3about 1 hour agoabout 1 hour ago
auth.criticspace.com1Yes3about 1 hour agoabout 1 hour ago
vfb-ukf7q.ondigitalocean.app0Yes1about 1 hour agoabout 1 hour ago
hyh-ebavs.ondigitalocean.app0Yes1about 1 hour agoabout 1 hour ago
frc-ustmo.ondigitalocean.app0Yes1about 1 hour agoabout 1 hour ago
kinectedchiro.com1Yes3about 1 hour agoabout 1 hour ago
1d704e67f0d.tc2links.com2Yes4about 1 hour agoabout 1 hour ago
srv44.hostserv.co.za1Yes3about 1 hour agoabout 1 hour ago
tasks.infoseccoding.com1Yes3about 1 hour agoabout 1 hour ago
67f05eab.xxi02r.shop0Yes1about 1 hour agoabout 1 hour ago
www70.oftware.com12Yes14about 1 hour agoabout 1 hour ago
ballinforcharity.org2Yes4about 1 hour agoabout 1 hour ago
csshpw.neverdrawbefore.top1Yes3about 1 hour agoabout 1 hour ago
mail.jptechdocsign.net1Yes3about 1 hour agoabout 1 hour ago
msjy34bga.hdjekcnk.com.cn0Yes1about 1 hour agoabout 1 hour ago
ww16.msjy34bga.hdjekcnk.com.cn0Yes1about 1 hour agoabout 1 hour ago
lor.login-microsoftonline-dhjj.in1Yes3about 1 hour agoabout 1 hour ago
wea.eor.cloudns.ph1Yes3about 1 hour agoabout 1 hour ago
propiter.com1Yes3about 1 hour agoabout 1 hour ago
milusi.ga0Yes1about 1 hour agoabout 1 hour ago
7749488e-438d3721.login-microsoftonline-dhjj.in1Yes3about 1 hour agoabout 1 hour ago
movinetenergia.com1Yes3about 1 hour agoabout 1 hour ago
etc-dewrewt.jungleheart.com0Yes1about 1 hour agoabout 1 hour ago
eki-fhtyiklb.yourtrap.com0Yes1about 1 hour agoabout 1 hour ago
amazon-pkujfd.sendsmtp.com0Yes1about 1 hour agoabout 1 hour ago
amazon-bufasafsa.sendsmtp.com0Yes1about 1 hour agoabout 1 hour ago
webmail.valleybls.com1Yes3about 1 hour agoabout 1 hour ago
brusque-purchaser.000webhostapp.com1Yes3about 1 hour agoabout 1 hour ago
xbrbgk.succesfuiiuck.com0Yes1about 1 hour agoabout 1 hour ago
organicandmineral.net1Yes3about 1 hour agoabout 1 hour ago
sberbank.sberbank.avito.sberbank.avito.avito.avito…0Yes1about 1 hour agoabout 1 hour ago
multivendor.sprint.xyz1Yes3about 1 hour agoabout 1 hour ago
dev-ebancaficotransfer.pantheonsite.io1Yes3about 1 hour agoabout 1 hour ago
facebook-com-fanny842.filesusr.com0Yes1about 1 hour agoabout 1 hour ago
avito.sber.avito.avito.avito.blablacar.sberbank.co…0Yes1about 1 hour agoabout 1 hour ago
avito.sber.avito.avito.avito.avito.avito.avito.avi…0Yes1about 1 hour agoabout 1 hour ago
amazonthree.duckdns.org1Yes3about 1 hour agoabout 1 hour ago
blablacar.sber.avito.blablacar.sber.blablacar.sber…0Yes1about 1 hour agoabout 1 hour ago
at-t-mail-support-d8799c.webflow.io3Yes5about 1 hour agoabout 1 hour ago
commbank.online-support.com.au0Yes1about 1 hour agoabout 1 hour ago
zxvk-ru.1gb.ru1Yes3about 1 hour agoabout 1 hour ago
locsubtc.info1Yes3about 1 hour agoabout 1 hour ago
workflow-authen.s3.us-west-004.backblazeb2.com3Yes5about 1 hour agoabout 1 hour ago
magic0724.andnroid.com2Yes4about 1 hour agoabout 1 hour ago
popshoco.wwwaz1-ts106.a2hosted.com0Yes1about 1 hour agoabout 1 hour ago
olisvffeds.myddns.me1Yes3about 1 hour agoabout 1 hour ago
interesting-curie.104-225-142-88.plesk.page0Yes1about 1 hour agoabout 1 hour ago
courierserviceupdate.wixsite.com0Yes1about 1 hour agoabout 1 hour ago
thestable.com.au0Yes1about 1 hour agoabout 1 hour ago
logn-account-live.com0Yes1about 1 hour agoabout 1 hour ago
zigzagbigheartedboolean.informaonline.repl.co1Yes3about 1 hour agoabout 1 hour ago
biomassvina.com1Yes3about 1 hour agoabout 1 hour ago
mctresas.wwwaz1-ss103.a2hosted.com0Yes1about 1 hour agoabout 1 hour ago
ignoranttemporaltelevision.informaonline.repl.co1Yes3about 1 hour agoabout 1 hour ago
login.info-ipromo.xyz0Yes1about 1 hour agoabout 1 hour ago
cbk.kg-zar.app2Yes4about 1 hour agoabout 1 hour ago
ww6.metamask-mobile.io1Yes3about 1 hour agoabout 1 hour ago
w.sodaslot.top2Yes4about 1 hour agoabout 1 hour ago
pertio.xyz1Yes3about 1 hour agoabout 1 hour ago
hexopb.xyz1Yes3about 1 hour agoabout 1 hour ago
s1669723775223.ignaciob.com1Yes3about 2 hours agoabout 1 hour ago
lazerlanes.com1Yes3about 2 hours agoabout 1 hour ago
healthdept.nw.gov.lk1Yes3about 2 hours agoabout 1 hour ago
salondemarieantoinette.com1Yes3about 2 hours agoabout 1 hour ago
6.ozymu.me0Yes1about 2 hours agoabout 1 hour ago
tasks.koichiendo.com1Yes3about 2 hours agoabout 2 hours ago
aminplusdiet.it1Yes3about 2 hours agoabout 2 hours ago
netstation.su02kiko1f4d8jp.com0Yes1about 2 hours agoabout 2 hours ago
medbed.technology1Yes3about 2 hours agoabout 2 hours ago
sender-api.xyz1Yes3about 2 hours agoabout 2 hours ago
fixedcrack.com1Yes3about 2 hours agoabout 2 hours ago
personasresources.transcolombia.repl.co1Yes3about 2 hours agoabout 2 hours ago
scarcenderstatedrnalcommand.bncolombasas.repl.co1Yes3about 2 hours agoabout 2 hours ago
www70.sharedfile.com12Yes14about 2 hours agoabout 2 hours ago
etc-zzzzxvvcv.toythieves.com0Yes1about 2 hours agoabout 2 hours ago
suu0tl4i77.bestellenapotheke.nl2Yes4about 2 hours agoabout 2 hours ago
www70.nettlohn.de12Yes14about 2 hours agoabout 2 hours ago
34yg4u64ra.preiswertkaufen.nl2Yes4about 2 hours agoabout 2 hours ago
8i528u.bestellenapotheke.nl2Yes4about 2 hours agoabout 2 hours ago
etc-cdsxacfdsv.jungleheart.com0Yes1about 2 hours agoabout 2 hours ago
fototony.com1Yes3about 2 hours agoabout 2 hours ago

TLP:CLEAR